PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016508570.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family BES1
Protein Properties Length: 332aa    MW: 35518.5 Da    PI: 8.1189
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016508570.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822206.38.3e-64371643131
          DUF822   3 sgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpleeaeaagssasaspesslqss 97 
                     ++rkp+w+ErEnn+rRERrRRa+aakiy+GLRaqGny+lpk +DnneVlkALc+eAGw+ve+DGtty+kg++p+  +e++g+sa+++p++s + s
  XP_016508570.1  37 GRRKPSWRERENNRRRERRRRAMAAKIYTGLRAQGNYNLPKNCDNNEVLKALCAEAGWIVEPDGTTYPKGCRPT-PMEIGGTSANITPSASRNPS 130
                     79************************************************************************.******************** PP

          DUF822  98 lkssalaspvesysaspksssfpspssldsisla 131
                     + ss++asp++sy++sp+sssfpsps+++ + ++
  XP_016508570.1 131 PPSSHFASPIPSYQPSPTSSSFPSPSRANANISS 164
                     ***************************8877544 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056878.2E-5937160IPR008540BES1/BZR1 plant transcription factor, N-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 332 aa     Download sequence    Send to blast
MMWEAGGGST ASSSAAGSGD GIGGAGVGLP ESGSNCGRRK PSWRERENNR RRERRRRAMA  60
AKIYTGLRAQ GNYNLPKNCD NNEVLKALCA EAGWIVEPDG TTYPKGCRPT PMEIGGTSAN  120
ITPSASRNPS PPSSHFASPI PSYQPSPTSS SFPSPSRANA NISSYPFAFL HNVIPSSLPP  180
LRISNSAPVT PPLSSPTRHP KQTFNLETLA KESMSALNFP FFAASAPASP TRGQRFTPPT  240
IPECDESDTS TIDSGQWINF QTYATNVPAS PTFNLVKPVA QPLCSNDIIT EKGKSIEFDF  300
ENVSVKAWEG ERIHDVGFDD LELTLGSGSA RV
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13756RRKPSWRERENNRRRERRRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016508570.10.0PREDICTED: protein BRASSINAZOLE-RESISTANT 1-like
SwissprotQ8S3071e-115BZR1_ARATH; Protein BRASSINAZOLE-RESISTANT 1
TrEMBLM1B8X31e-171M1B8X3_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000398791e-170(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA28122454
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75080.25e-94BES1 family protein